
Amid Biosciences | Protein Engineering Company
KRAS Protein, Human, Recombinant, AviTag
Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development.

Image from National Cancer Institute (NCI): https://visualsonline.cancer.gov/details.cfm?imageid=11166
Recombinant KRAS protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).
Sequence of recombinant human KRAS (amino acids 1 – 185; isoform 2B (UNIPROT: P01116-2))
MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCL
LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD
LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Catalog # KRAS-301-1
For Bulk Orders or Custom Packaging: please contact : info@amidbiosciences.com
Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, 1 mM DTT and 50% Glycerol.
Concentration: 1.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
International Shipping: Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.