Wild Type KRAS Protein, Human, Recombinant, AviTag

Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development.

Image from National Cancer Institute (NCI): https://visualsonline.cancer.gov/details.cfm?imageid=11166

Recombinant KRAS protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase). 

Sequence of recombinant human KRAS (amino acids 1 – 185; isoform KRAS4B (UNIPROT: P01116-2)) 

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM

RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD

LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Catalog # KRAS-301-1

For Bulk Orders or Custom Packaging: please contact : info@amidbiosciences.com

Storage buffer: 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl₂ and 10% Glycerol
Concentration: 1.0 mg/mL by A280 
Purity: >90% by Coomassie staining 
Storage is recommended at -80°C for longer periods of time. 

International Shipping:  Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates

This product is for laboratory research use only.