Streptavidin, Recombinant, His-Tag | High Purity & Activity
Streptavidin, Recombinant, His-Tag | High Purity & Activity
Couldn't load pickup availability

Streptavidin is a homo-tetrameric protein secreted by Streptomyces avidinii. Streptavidin is used extensively in molecular biology for its extraordinarily high affinity for biotin. The binding of biotin to streptavidin is one of the strongest non-covalent interactions known in nature with a dissociation constant (Kd) of the biotin-streptavidin complex on the order ~10-14 mol/L. The streptavidin/biotin complex is extremely stable over a wide range of temperature and pH. Because streptavidin lacks any carbohydrate modification and has a near-neutral pI, it has the advantage of much lower nonspecific binding than avidin.
Recombinant Streptavidin is produced in E. coli as an N- and C-terminal shortened variant (core streptavidin, amino acids 13-139) and purified by proprietary chromatographic techniques. A single, non-glycosylated polypeptide chain contains a total of 136 amino acids including the N-terminal His-Tag and having a molecular mass of 14.4 kDa. The molecular weight per tetramer is approximately 57.7 kDa.
Catalog #: STR-301-5 (5 mg), STR-301-25 (25 mg), STR-301-100 (100 mg)
This product is for laboratory research use only.
Streptavidin sequence:
MHHHHHHKLAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Storage buffer: 40 mM Phosphate buffer, pH 7.2, 120 mM NaCl, 0.05% Tween 20, 20% glycerol
Activity: Greater than 16 U/mg, 1 unit binds 1 µg of d-biotin
Storage is recommended at -20°C for longer periods of time. Minimize freeze/thaw cycles
Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates
Application References:
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.