Recombinant Human STING Protein (H232 Variant) for Research Applications | Amid Biosciences
Recombinant Human STING Protein (H232 Variant) for Research Applications | Amid Biosciences
Couldn't load pickup availability

The Human STING (Stimulator of Interferon Genes) H232 variant (TMEM173) is a naturally occurring isoform characterized by a histidine substitution at amino acid 232.
This high-purity, recombinant human STING protein represents the H232 variant which is heavily utilized in structural studies and assay development to understand STING's role in innate immune signaling pathways in a laboratory setting.
Unlike the R232, the H232 variant demonstrates reduced binding affinity to 2'-3' cGAMP
Key Features & Technical Specifications:
- Variant Specificity: Contains the H232 (His232) polymorphism, essential for studying natural variations in the STING signaling pathway.
- High Purity & Activity: Purified to >85% via affinity chromatography, ensuring consistent results in ligand-binding studies and enzymatic assays.
- Research Utility: Optimized for in-vitro analysis of 2'-3' cGAMP interactions and the characterization of downstream signaling cascades.
- Flexible Format: Available in multiple concentrations (including 0.1 mg and 1.0 mg) to support both small-scale screening and large-scale structural studies.
- Strictly for Research Use: This product is intended for laboratory research and development only. It is not for human or animal diagnostic or therapeutic use.
Sequence of human STING H232 variant:
MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Tag(s): 8XHis tag at the N-terminus
Expression host: Escherichia coli (E. coli)
Expressed Region of STING protein: Leu139 - Ser379 (UniProt # Q86WV6)
Purity: > 85% as analyzed by SDS-PAGE
Storage buffer: 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20
Storage: at -80°C. Avoid repeated freezing and thawing cycles
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.