STING Protein, Human, H232 variant, Recombinant
STING Protein, Human, H232 variant, Recombinant
Couldn't load pickup availability

Human transmembrane protein 173 (TMEM173) gene encodes the STING protein (Stimulator of Interferon Genes, also known as TMEM173, HMITA, NET23, ERIS, MPYS, MITA, SAVI). STING is a major regulator of the innate immune response to viral and bacterial infections and promotes the production of type I interferon (IFN-alpha and IFN-beta).
The initial identified human STING has a histidine at amino acid 232 (H232 variant). The most common TMEM173 allele in the human population has an arginine at amino acid 232 (R232) (1). Amid Biosciences offers purified recombinant human STING H232 and R232 variants, respectively.
Recombinant STING corresponding to amino acids 139-379 of human STING H232 allele (UniProtKB - Q86WV6) was expressed in E. coli cells and contains a His tag at the N-terminus.
Catalog # STGH-301
For laboratory research use only. Direct human use, including taking orally or by injection and clinical use is forbidden.
Sequence of human STING H232 variant:
MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Tag(s): His tag at the N-terminus
Expression host: Escherichia coli (E. coli)
Expressed Region of STING protein: Leu139 - Ser379
Purity: > 90% as analyzed by SDS-PAGE
Storage buffer: 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20
Storage: The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.