Recombinant Sortase A Enzyme for Protein Labeling | Amid Bio
Recombinant Sortase A Enzyme for Protein Labeling | Amid Bio
Couldn't load pickup availability

Product Overview
Staphylococcus aureus Sortase A (srtA) is a recombinant transpeptidase engineered for highly efficient, site-specific protein engineering and bioconjugation. By recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid) between the threonine and glycine residues, Sortase A forms a covalent acyl-enzyme intermediate.
The terminal glycine is subsequently replaced with a poly-Glycine (Gly)n nucleophile (where n ≥ 3), enabling precise, robust attachment of a wide range of labels—including HRP, biotin, fluorophores, and custom peptides.
This product is for research use only.
Key Features & Applications
- Site-Specific Labeling: Achieve homogenous modifications without disrupting the protein's native structure or activity.
- Versatile Bioconjugation: Ideal for antibody-drug conjugate (ADC) discovery, peptide ligation, and cell-surface labeling.
- Calcium-Dependent Activity: Standard catalytic activity relies on the presence of calcium ions (Ca2+).
- Easy Purification: Features an N-terminal 6×His-tag for straightforward downstream removal if required.
Technical Specifications
- Source: Staphylococcus aureus (Amino acids 26–206)
- Expression Host: E. coli
- Molecular Weight: 22.2 kDa
- Purity: > 90% by SDS-PAGE
- Storage Buffer: 20 mM HEPES (pH 7.5), 0.1 M NaCl, 20% glycerol
Source: S. aureus
Amino acids: 26- 206 (UniProt# Q2FV99)
Molecular weight: 22.2 kDa
Expression host: E. coli
Tag(s): N-terminal 6X His
Purity: > 90%
Storage buffer: 20 mM HEPES, pH 7.5, 0.1 M NaCl, 20% glycerol.
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Thaw on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen.
The S. aureus sortase A sequence: amino acids (26-206).
KPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates.
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.