Sortase A, Recombinant
Sortase A, Recombinant
Couldn't load pickup availability
Staphylococcus aureus Sortase A (srtA) belongs to a class of transpeptidases that utilize an active site cysteine thiol to modify proteins by recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid), between the threonine and glycine residues. The terminal glycine is then replaced with any poly-Glycine (Gly)n label (where n= 3 or more glycine residues) to attach HPR, biotin, fluorophores and other labels. The enzyme is calcium dependent.
Recombinant Staphylococcus aureus Sortase A is expressed in E. coli with an N-terminal His-tag.
Catalog # SRTA-301
This product is for research use only.
Target Protein (Donor): Genetically modified to have a C-terminal LPXTG motif.
Linker/Acceptor Molecule: Modified with a poly-glycine or aminomethylene tag
Source: S. aureus
Amino acids: 26- 206 (UniProt# Q2FV99)
Molecular weight: 22.2 kDa
Expression host: E. coli
Tag(s): N-terminal 6X His
Purity: > 90%
Storage buffer: 20 mM HEPES, pH 7.5, 0.1 M NaCl, 20% glycerol.
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Thaw on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen.
The S. aureus sortase A sequence: amino acids (26-206).
KPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates.
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.