![Saposin C, Human, Recombinant | Activator of Lysosomal Glycosphingolipid Hydrolases | Essential Activator for Glucocerebrosidase - the Enzyme Deficient in Gaucher Disease](http://amidbiosciences.com/cdn/shop/products/Saposin_C_Human_Recombinant_1024x1024.jpg?v=1676683176)
Amid Biosciences | Protein Engineering Company
Saposin C, Human, Recombinant
Human saposin C is small, heat-stable glycoprotein activator of lysosomal glycosphingolipid hydrolases that derive from a single precursor, prosaposin, by proteolytic cleavage. Of the prosaposin derived saposins, saposin C shows the highest amino acid identity/similarity to saposin A. Saposin C is an essential activator for glucocerebrosidase, the enzyme deficient in Gaucher disease (1, 2). It plays role in antigen presentation of lipids through CD1b to human T cells (3). Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays (2).
Recombinant human saposin C is produced in E. coli and purified by proprietary chromatography techniques.
Saposin C sequence:
SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG
Catalog # SAPC-302-1
Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol.
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
International Shipping: Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.
References