Saposin C, Human, Recombinant
Saposin C, Human, Recombinant
Couldn't load pickup availability

Human saposin C is small, heat-stable glycoprotein activator of lysosomal glycosphingolipid hydrolases that derive from a single precursor, prosaposin, by proteolytic cleavage. Of the prosaposin derived saposins, saposin C shows the highest amino acid identity/similarity to saposin A. Saposin C is an essential activator for glucocerebrosidase, the enzyme deficient in Gaucher disease (1, 2). It plays role in antigen presentation of lipids through CD1b to human T cells (3). Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays (2).
Recombinant human saposin C is produced in E. coli and purified by proprietary chromatography techniques.
Catalog # SAPC-302-1
This product is for laboratory research use only.
Saposin C sequence:
SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG
Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time
International Shipping: Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates
References:
- Qi. X. et al. Differential membrane interactions of saposins A and C: implications for the functional specificity. J Biol Chem. 2001 Jul 20; 276(29): 27010-7.
- Qi, X. et al. Functional human saposins expressed in Escherichia coli. Evidence for binding and activation properties of saposins C with acid beta-glucosidase. J Biol Chem. 1994 Jun 17; 269(24):16746-53.
- Winau, F. et al. Saposin C is required for lipid presentation by human CD1b. Nature Immunology, 2004, 5, 169–174.
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.