KRAS Y96D Protein, Human, Recombinant, Biotinylated
KRAS Y96D Protein, Human, Recombinant, Biotinylated
Couldn't load pickup availability

Recombinant KRAS Y96D protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme.
Catalog # KRAS96D-B-301
This product is for laboratory research use only.
Sequence of recombinant human KRAS Y96D protein (amino acids 1 – 185; Y96D mutant variant of isoform KRAS4B (UNIPROT: P01116-2))
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHDREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Storage buffer: 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl2 and 10% Glycerol
Concentration: 1.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen
Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
For Bulk Orders or Custom Packaging: Contact info@amidbiosciences.com
International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates
- Choosing a selection results in a full page refresh.
- Opens in a new window.