Wild Type KRAS Protein, Human, Recombinant, Biotinylated

Recombinant KRAS protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).

Sequence of recombinant human KRAS (amino acids 1 – 185; isoform KRAS4B (UNIPROT: P01116-2)) 

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM

RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD

LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.

Catalog # KRAS-301-B-1

For Bulk Orders or Custom Packaging: please contact at info@amidbiosciences.com

Storage buffer: 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl₂, 1 mM 2-mercapthoethanol, 10% glycerol. 
Concentration: 1.0 mg/mL by A280 
Purity: >90% by Coomassie staining 
Storage is recommended at -80°C for longer periods of time. 

International Shipping:  Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates

This product is for laboratory research use only.