Sequence of recombinant human KRAS G13D protein (amino acids 1 – 185; G13D mutant variant of isoform KRAS4B (UNIPROT: P01116-2))
MTEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Storage buffer: 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol
Concentration: 1.0-2.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen
