Protein Engineering Company
Cart 0
KRAS G12D Protein Human Recombinant Biotinylated | Cancer Drug Discovery | SDS-PAGE

Amid Biosciences | Protein Engineering Company

KRAS G12D protein, Human, Recombinant, Biotinylated

$ 500.00

Recombinant KRAS G12D protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).

Sequence of recombinant human KRAS G12D protein (amino acids 1 – 185; G12D mutant variant of isoform KRAS4B (UNIPROT: P01116-2))

MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM

RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD

LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.

Catalog # KRAS12D-B-301-005 (size: 0.05 mg); KRAS12D-B-301-01 (size: 0.1 mg);
KRAS12D-B-301-1 (size: 1 mg). 

For Bulk Orders or Custom Packaging:  please contact info@amidbiosciences.com

Storage buffer: 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol. 
Concentration: 1.0 mg/mL by A280 
Purity: >90% by Coomassie staining

Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen.

International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates.

This product is for laboratory research use only.

KRAS Protein Structure Image from National Cancer Institute (NCI):  https://visualsonline.cancer.gov/details.cfm?imageid=11166


Share this Product


More from this collection