KRAS G12D protein, Human, Recombinant, Biotinylated || Amid Biosciences

Recombinant KRAS G12D protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).

Sequence of recombinant human KRAS G12D protein (amino acids 1 – 185; G12D mutant variant of isoform 2B (UNIPROT: P01116-2))

MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCL

LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD

LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Catalog # KRAS12D-B-301

For Bulk Orders or Custom Packaging:  please contact info@amidbiosciences.com

Storage buffer: 20 mM Tris-HCl, pH 7.5, 200 mM NaCl, 10 mM 2-mercaptoethanol, 0.1% Tween 20 and 10% Glycerol. 
Concentration: 0.5 mg/mL by A280 
Purity: >90% by Coomassie staining 
Storage is recommended at -20°C for longer periods of time. 

International Shipping:  Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates

This product is for laboratory research use only.

KRAS Protein Structure Image from National Cancer Institute (NCI):  https://visualsonline.cancer.gov/details.cfm?imageid=11166