
Amid Biosciences | Protein Engineering Company
KRAS G12C Protein, Human, Recombinant, AviTag
Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development. The four most frequent KRAS mutations are G12D, G12V, G13D, and G12C.

Image from National Cancer Institute (NCI): https://visualsonline.cancer.gov/details.cfm?imageid=11166
Recombinant KRAS G12C protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/biotinylation-tools-streptavidins/products/bira-biotin-ligase-in-vitro-biotynilation).
Sequence of recombinant human KRAS G12C protein (amino acids 1 – 185; G12C mutant variant of isoform 2B (UNIPROT: P01116-2))
MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCL
LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD
LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
For Bulk Orders or Custom Packaging: please contact info@amidbiosciences.com
Storage buffer: 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl2 and 10% Glycerol
Concentration: 1.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
International Shipping: Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.