Streptavidin Recombinant | Amid Biosciences
Streptavidin Recombinant | Amid Biosciences
Couldn't load pickup availability

Recombinant Streptavidin (Core, High Purity & Activity)
Recombinant Streptavidin is a homo-tetrameric protein produced in E. coli as an N- and C-terminal shortened variant (core streptavidin, amino acids 13–139). It is purified using proprietary chromatographic techniques to ensure maximum purity and excellent activity.
Because it lacks carbohydrate modifications and has a near-neutral isoelectric point (pI), our recombinant streptavidin offers significantly lower non-specific binding compared to native avidin, making it ideal for sensitive molecular biology applications.
Key Features & Specifications
- High Affinity: Binds D-biotin with a dissociation constant (Kd) of ~1.0 x 10^-14 mol/L, one of the strongest non-covalent interactions in nature.
- Exceptional Stability: The streptavidin-biotin complex remains stable across a wide range of temperatures and pH levels.
- High Activity: Greater than 16 U/mg (1 unit binds 1 µg of D-biotin).
- Formulation: Supplied as a 5 mg/mL solution in 0.5X PBS buffer (pH 7.4) and 50% glycerol.
- Molecular Weight: 13.4 kDa per monomer (single, non-glycosylated polypeptide chain of 128 amino acids); approximately 53.6 kDa per functional tetramer.
Applications
Optimized for use in high-performance downstream research applications, including:
- Enzyme-Linked Immunosorbent Assays (ELISA detection)
- Flow Cytometry and Immunohistochemistry
- Western Blotting and Protein Purification
- FISH (Fluorescence In Situ Hybridization) and Microarrays
Catalog # ST-302-5 (5 mg), ST-302-25 (25 mg).
This product is for research use only (RUO).
Streptavidin sequence:
MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Source: E.Coli
The Streptavidin solution (5 mg/ml) contains 0.5XPBS buffer, pH 7.4 and 50% glycerol
Molecular weight: A single, non-glycosylated polypeptide chain contains a total of 128 amino acids with a molecular mass of 13.4 kDa. The molecular weight per tetramer is approximately 53.6 kDa
Activity: Greater than 16 U/mg, 1 unit binds 1 µg of d-biotin
Storage is recommended at -20°C for longer periods of time. Minimize freeze/thaw cycles
Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates
References:
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.