
Amid Biosciences | Protein Engineering Company
KRAS Y96D Protein, Human, Recombinant, AviTag
Recombinant KRAS Y96D protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme.
Sequence of recombinant human KRAS Y96D protein (amino acids 1 – 185; Y96D mutant variant of isoform KRAS4B (UNIPROT: P01116-2))
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM
RDQYMRTGEGFLCVFAINNTKSFEDIHHDREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD
LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Catalog # KRAS96D-301
For Bulk Orders or Custom Packaging: please contact info@amidbiosciences.com
Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
Storage buffer: 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl2 and 10% Glycerol
Concentration: 1.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen.
International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.