![KRAS G12R Protein Human Recombinant Biotinylated | Cancer Drug Discovery](http://amidbiosciences.com/cdn/shop/products/KRAS_G12R_Protein_Human_Recombinant_Biotinylated_1024x1024.jpg?v=1673912509)
Amid Biosciences | Protein Engineering Company
KRAS G12R Protein, Human, Recombinant, Biotinylated
Recombinant KRAS G12R protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).
Sequence of recombinant human KRAS G12R protein (amino acids 1 – 185; G12R mutant variant of isoform KRAS4B (UNIPROT: P01116-2))
MTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM
RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQA
QDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Catalog # KRAS12R-B-301
Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
For Bulk Orders or Custom Packaging: please contact info@amidbiosciences.com
Storage buffer: 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol.
Concentration: 1.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen.
International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.
KRAS Protein Structure Image from National Cancer Institute (NCI): https://visualsonline.cancer.gov/details.cfm?imageid=11166