STING Protein, Human, R232 variant, Recombinant

Human transmembrane protein 173 (TMEM173) gene encodes the STING protein (Stimulator of Interferon Genes, also known as TMEM173, HMITA, NET23, ERIS, MPYS, MITA, SAVI). STING is a major regulator of the innate immune response to viral and bacterial infections and promotes the production of type I interferon (IFN-alpha and IFN-beta).

The initial identified human STING has a Histidine at amino acid 232 (H232). The most common TMEM173 allele in the human population has an Arginine at amino acid 232 (R232) (1). Amid Biosciences offers purified recombinant human STING H232 and R232 variants, respectively.

Recombinant STING corresponding to amino acids 139-379 of human STING R232 allele was expressed in E. coli cells and contains a His tag at the N-terminus.

Catalog number: STGR-301

Expression host: Escherichia coli (E. coli).

Expressed Region of STING protein: Leu139 - Ser379

Sequence of human STING R232 variant:

MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDC
GVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLE
QAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLIS
GMEKPLPLRTDFS

Purity: > 90% as analyzed by SDS-PAGE

Storage buffer: 20 mM Tris-HCl, pH 8.0, 150mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20

Storage: The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

References

Patel, S. and Jin, L. TMEM173 variants and potential importance to human biology and disease. Genes & Immunity (2019) 20:82–89. https://doi.org/10.1038/s41435-018-0029-9