STING Protein, Human Recombinant (R232) | Amid Biosciences
STING Protein, Human Recombinant (R232) | Amid Biosciences
Couldn't load pickup availability

This high-purity recombinant human STING (Stimulator of Interferon Genes) protein features the R232 (Arg232) variant, a key polymorphism used in the study of innate immune responses. This product is specifically developed for researchers performing biochemical characterization, protein-protein interaction studies, and structural analysis in a laboratory environment.
Key Technical Specifications:
- Variant Specificity: Contains the R232 polymorphism (Arg232), a critical variant for comparative studies against the H232 allele.
- High-Level Purity: Purified via advanced affinity chromatography to ensure >95% purity, providing reliable and reproducible results in enzymatic and binding assays.
- Application Versatility: Optimized for in-vitro use, including cGAMP binding studies, interferon signaling research, and the development of innate immunity assays.
- Research Grade: Provided in a stable, buffered solution designed to maintain protein integrity through multiple freeze-thaw cycles.
- Strictly for Research Use: This product is intended for in-vitro laboratory research and development only. It is not for human or animal diagnostic or therapeutic use.
Catalog # STGR-301
Sequence of human STING R232 variant:
MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Tag(s): His tag at the N-terminus
Expression host: Escherichia coli (E. coli)
Expressed Region of STING protein: Leu139 - Ser379 (UniProt # Q86WV6)
Purity: > 85% as analyzed by SDS-PAGE
Storage buffer: 20 mM Tris-HCl, pH 8.0, 150mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20
Storage: -80°C. Avoid repeated freezing and thawing cycles
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.