Saposin B, Human, Recombinant
Saposin B, Human, Recombinant
Couldn't load pickup availability

Saposin B is a small (79 amino acids), non-enzymatic glycosphingolipid activator protein required for the breakdown of cerebroside sulfates (sulfatides) in lysosomes. The protein can extract target lipids from membranes, forming soluble protein-lipid complexes that are recognized by arylsulfatase A.
Recombinant human saposin B is produced in E. coli as an N-terminal His-tag fusion and purified by proprietary chromatography techniques with subsequent removal of the tag through a site-specific proteolytic cleavage. Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays.
Catalog # SAPB-301
This product is for laboratory research use only.
Saposin B sequence
GDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDE
Storage buffer: 25 mM Phosphate Buffer, pH 7.2, 75 mM NaCl, and 50% Glycerol
Concentration: 0.5 - 2.0 mg/mL by A280 (E1% 3.4) (please see protein concentration for specific lot number on the vials for this product)
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.