Streptavidin, Recombinant, His-Tag | High Purity & Activity

Recombinant Streptavidin is a homo-tetrameric protein variant (core streptavidin, amino acids 13-139) produced in E. coli and purified using proprietary chromatographic techniques. Consisting of a single, non-glycosylated polypeptide chain of 136 amino acids, it includes an N-terminal His-Tag and features a molecular mass of 14.4 kDa (approximately 57.7 kDa per tetramer).

Streptavidin is widely used in molecular biology due to its extraordinarily high affinity for biotin (Kd of 1 x 10^-14 mol/L). Because it lacks carbohydrate modifications and maintains a near-neutral pI, it yields significantly lower non-specific binding compared to native avidin.

Key Features & Applications:

• High Affinity & Stability: The streptavidin-biotin complex remains exceptionally stable across broad pH and temperature ranges.
• Versatile Workflows: Ideal for affinity protein purification, immunoassays, Western blotting, ELISA detection, histochemistry, FISH, and cellular imaging.
• Convenient Tagging: Equipped with an N-terminal His-Tag for seamless detection or secondary immobilization.

Specifications:

• Activity: Greater than 16 U/mg (1 unit binds 1 µg of D-biotin).
• Storage Buffer: 40 mM Phosphate buffer (pH 7.2), 120 mM NaCl, 0.05% Tween 20, 20% glycerol.
• Formulation Sequence: MHHHHHHKLAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
• Catalog Numbers: STR-301-1 (1 mg), STR-301-5 (5 mg), STR-301-25 (25 mg), STR-301-100 (100 mg).

Validated Applications & Recent Citations:

• Mackin RT, Edwards JV, Atuk EB, et al. Structure/Function Analysis of Truncated Amino-Terminal ACE2 Peptide Analogs That Bind to SARS-CoV-2 Spike Glycoprotein.Molecules. 2022;27(7):2070. Published 2022 Mar 23. doi:10.3390/molecules27072070
• Borner T, Tinsley IC, Milliken BT, et al. Creation of a Peptide Antagonist of the GFRAL-RET Receptor Complex for the Treatment of GDF15-Induced Malaise. J Med Chem. 2023;66(16):11237-11249. doi:10.1021/acs.jmedchem.3c00667

 Intended Use: For laboratory research use only.