Streptavidin, Recombinant, His-Tag | High Purity & Activity
Streptavidin, Recombinant, His-Tag | High Purity & Activity
Couldn't load pickup availability

Recombinant Streptavidin is a homo-tetrameric protein variant (core streptavidin, amino acids 13-139) produced in E. coli and purified using proprietary chromatographic techniques. Consisting of a single, non-glycosylated polypeptide chain of 136 amino acids, it includes an N-terminal His-Tag and features a molecular mass of 14.4 kDa (approximately 57.7 kDa per tetramer).
Streptavidin is widely used in molecular biology due to its extraordinarily high affinity for biotin (Kd of 1 x 10^-14 mol/L). Because it lacks carbohydrate modifications and maintains a near-neutral pI, it yields significantly lower non-specific binding compared to native avidin.
Key Features & Applications:
- High Affinity & Stability: The streptavidin-biotin complex remains exceptionally stable across broad pH and temperature ranges.
- Versatile Workflows: Ideal for affinity protein purification, immunoassays, Western blotting, ELISA detection, histochemistry, FISH, and cellular imaging.
- Convenient Tagging: Equipped with an N-terminal His-Tag for seamless detection or secondary immobilization.
Specifications:
- Activity: Greater than 16 U/mg (1 unit binds 1 µg of D-biotin).
- Storage Buffer: 40 mM Phosphate buffer (pH 7.2), 120 mM NaCl, 0.05% Tween 20, 20% glycerol.
- Formulation Sequence: MHHHHHHKLAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
- Catalog Numbers: STR-301-1 (1 mg), STR-301-5 (5 mg), STR-301-25 (25 mg), STR-301-100 (100 mg).
Validated Applications & Recent Citations:
- Mackin RT, Edwards JV, Atuk EB, et al. Structure/Function Analysis of Truncated Amino-Terminal ACE2 Peptide Analogs That Bind to SARS-CoV-2 Spike Glycoprotein.Molecules. 2022;27(7):2070. Published 2022 Mar 23. doi:10.3390/molecules27072070
- Borner T, Tinsley IC, Milliken BT, et al. Creation of a Peptide Antagonist of the GFRAL-RET Receptor Complex for the Treatment of GDF15-Induced Malaise. J Med Chem. 2023;66(16):11237-11249. doi:10.1021/acs.jmedchem.3c00667
Intended Use: For laboratory research use only.
Streptavidin sequence:
MHHHHHHKLAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Storage buffer: 40 mM Phosphate buffer, pH 7.2, 120 mM NaCl, 0.05% Tween 20, 20% glycerol
Activity: Greater than 16 U/mg, 1 unit binds 1 µg of d-biotin
Storage is recommended at -20°C for longer periods of time. Minimize freeze/thaw cycles
Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates
Application References:
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.