Saposin B, Human, Recombinant
Saposin B, Human, Recombinant
Couldn't load pickup availability

Saposin B (SAP-B) is a small, non-enzymatic glycosphingolipid activator protein essential for the lysosomal degradation of cerebroside sulfates (sulfatides). It functions as a biological detergent, physically extracting target lipid molecules from biological membranes to form a soluble, transportable protein-lipid complex. This presentation renders the substrate accessible to the hydrolytic enzyme arylsulfatase A (ARSA). Deficiencies or genetic mutations in the prosaposin gene leading to a loss of functional Saposin B result in Saposin B deficiency, a rare lysosomal storage disease phenotypically resembling metachromatic leukodystrophy (MLD).
Key Research & Assay Applications
- Enzyme Replacement & Activity Assays: Ideal as a functional cofactor for reconstituting in vitro arylsulfatase A degradation kinetics and lipid editing mechanics.
- Immunology & NKT Cell Activation: Used in downstream investigations profiling phospholipid transfer dynamics and lipid antigen presentation to Natural Killer T (NKT) cells.
- Drug Discovery Support: High-value target component for screening therapeutics, small molecules, or chaperone designs aiming to mitigate metachromatic leukodystrophy pathways.
Product Features & Specifications
- Expression System: Engineered and produced in an optimized Escherichia coli (E. coli) bacterial expression platform.
- Tag Status: Expressed as an N-terminal His-tag fusion and purified using proprietary chromatography steps, followed by site-specific proteolytic cleavage to yield a completely tag-free final protein.
- Sequence Profile: Comprises the native 79-amino acid mature Saposin B sequence (GDVCQDCIQM...CDE).
- High Purity: Formulated to >90% purity as verified by Coomassie blue staining on SDS-PAGE.
- Buffer Formulation: Supplied at a concentration of 0.5 – 2.0 mg/mL in 25 mM Phosphate Buffer, pH 7.2, 75 mM NaCl, and 50% Glycerol for premium structural stability.
Catalog Number: SAPB-301 | This product is intended for laboratory research use only (RUO). Long-term storage is recommended at -20°C.
Saposin B sequence
GDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDE
Storage buffer: 25 mM Phosphate Buffer, pH 7.2, 75 mM NaCl, and 50% Glycerol
Concentration: 0.5 - 2.0 mg/mL by A280 (E1% 3.4) (please see protein concentration for specific lot number on the vials for this product)
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time
Domestic Shipping in the US
Temperature sensitive products requiring shipping/handling on dry ice are shipped via UPS Next Day Air Saver. These products are delivered the next day if your order is placed before 3 PM PST. A dry ice surcharge is included in the shipping cost at checkout. For orders totaling over $1,000, free shipping and handling will be applied to the order.
International Shipping
Orders to be shipped internationally (outside of the US) can be shipped via DHL Express Worldwide or FedEx International Priority. Please contact info@amidbiosciences.com if you would like your company's shipping account to be used for the order. Our customers have sometimes negotiated lower shipping rates than us.
- Choosing a selection results in a full page refresh.
- Opens in a new window.