KRAS G12V Protein, Human, Recombinant, AviTag

Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development.

Recombinant KRAS G12V protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).

Sequence of recombinant human KRAS G12V protein (amino acids 1 – 185; G12V mutant variant of isoform 2B (UNIPROT: P01116-2))

MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCL

LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD

LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.

Catalog # KRAS12V-301

For Bulk Orders or Custom Packaging:  please contact info@amidbiosciences.com

Storage buffer: 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl₂ and 10% Glycerol.
Concentration: 1.0 mg/mL by A280 
Purity: >90% by Coomassie staining 
Storage is recommended at -20°C for longer periods of time. 

International Shipping:  Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates

This product is for laboratory research use only.

KRAS Protein Structure Image from National Cancer Institute (NCI):  https://visualsonline.cancer.gov/details.cfm?imageid=11166