KRAS G12R Protein, Human, Recombinant, AviTag

Sequence of recombinant human KRAS G12R protein (amino acids 1 – 185; G12R mutant variant of isoform KRAS4B (UNIPROT: P01116-2))

MTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Storage buffer: 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl2 and 10% Glycerol

Concentration: 1.0 mg/mL by A280

Purity: >90% by Coomassie staining

Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen