
Amid Biosciences | Protein Engineering Company
Saposin B, Human, Recombinant
Saposin B is a small (79 amino acids), non-enzymatic glycosphingolipid activator protein required for the breakdown of cerebroside sulfates (sulfatides) in lysosomes. The protein can extract target lipids from membranes, forming soluble protein-lipid complexes that are recognized by arylsulfatase A.
Recombinant human saposin B is produced in E. coli as an N-terminal His-tag fusion and purified by proprietary chromatography techniques with subsequent removal of the tag through a site-specific proteolytic cleavage. Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays.
Saposin B sequence
GDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDE
Catalog number: SAPB-301
Storage buffer: 25 mM Phosphate Buffer, pH 7.2, 75 mM NaCl, and 50% Glycerol.
Concentration: 0.5 - 2.0 mg/mL by A280 (E1% 3.4) (please see protein concentration for specific lot number on the vials for this product)
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
This product is for laboratory research use only.