Recombinant KRAS G13D protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and a site-specifically biotinylated with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).
Sequence of recombinant human KRAS G13D protein (amino acids 1 – 185; G13D mutant variant of isoform KRAS4B (UNIPROT: P01116-2))
MTEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM
RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD
LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed upon request as a custom service.
Catalog # KRAS13D-B-301
For Bulk Orders or Custom Packaging: please contact info@amidbiosciences.com
Storage buffer: 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol.
Concentration: 1.0-2.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
International Shipping: Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.
KRAS Protein Structure Image from National Cancer Institute (NCI): https://visualsonline.cancer.gov/details.cfm?imageid=11166