Recombinant KRAS G12D protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme.
Sequence of recombinant human KRAS G12D protein (amino acids 1 – 185; G12D mutant variant of isoform KRAS4B (UNIPROT: P01116-2))
MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM
RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD
LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
Catalog # KRAS12D-B-301-005 (size: 0.05 mg); KRAS12D-B-301-01 (size: 0.1 mg);
KRAS12D-B-301-1 (size: 1 mg).
For Bulk Orders or Custom Packaging: please contact info@amidbiosciences.com
Storage buffer: 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol.
Concentration: 1.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen.
International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates.
This product is for laboratory research use only.