
Amid Biosciences | Protein Engineering Company
Saposin B, Human, Recombinant
Saposin B is a small (79 amino acids), non-enzymatic glycosphingolipid activator protein required for the breakdown of cerebroside sulfates (sulfatides) in lysosomes. The protein can extract target lipids from membranes, forming soluble protein-lipid complexes that are recognized by arylsulfatase A.
Recombinant human saposin B is produced in E. coli as an N-terminal His-tag fusion and purified by chromatography techniques with subsequent removal of the tag trough a site-specific proteolytic cleavage. Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays.
Saposin B sequence
GDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDE
Catalog number: SAPB-301
Storage buffer: 50 mM Tris-HCl, pH 7.5, 50 mM NaCl, and 50% Glycerol.
Concentration: 1.0 mg/mL by A280 (E1% 3.4)
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
This product is for laboratory research use only.