Amid Biosciences | Protein Engineering Company
KRAS G12V Protein, Human, Recombinant, AviTag
Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development.
Recombinant KRAS G12V protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase).
Sequence of recombinant human KRAS G12V protein (amino acids 1 – 185; G12V mutant variant of isoform KRAS4B (UNIPROT: P01116-2))
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM
RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD
LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
Catalog # KRAS12V-301
For Bulk Orders or Custom Packaging: please contact info@amidbiosciences.com
Storage buffer: 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl2 and 10% Glycerol.
Concentration: 1.0 mg/mL by A280
Purity: >90% by Coomassie staining
Storage is recommended at -70°C/-80°C for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen.
International Shipping: Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.
KRAS Protein Structure Image from National Cancer Institute (NCI): https://visualsonline.cancer.gov/details.cfm?imageid=11166
