Protein Engineering Company
Cart 0
Wild Type KRAS Protein, Human, Biotinylated, Without a His-tag - RAS Proteins

Amid Biosciences | Protein Engineering Company

Wild Type KRAS Protein, Human, Biotinylated, Without a His-tag

$ 1,200.00

Recombinant KRAS protein with the N-terminal AviTag™ peptide is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme.

Sequence of recombinant human KRAS (amino acids 1 – 185; isoform KRAS4B (UNIPROT: P01116-2)) 

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM

RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD

LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.

Catalog # KRAS-B-302

For Bulk Orders or Custom Packaging: please contact at info@amidbiosciences.com

Storage buffer: 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol. 
Concentration: 1.0 mg/mL by A280 
Purity: >90% by Coomassie staining

Storage is recommended at -80°C for longer periods of time. 

International Shipping:  Product requires shipping on dry ice. Please contact info@amidbiosciences.com for shipment estimates

This product is for laboratory research use only.


Share this Product


More from this collection