Protein Engineering Company
Cart 0
SARS-CoV-2 Spike RBD Protein, Recombinant, AviTag

Amid Biosciences | Protein Engineering Company

SARS-CoV-2 Spike RBD Protein, Recombinant, AviTag

$ 200.00

The coronavirus Spike protein (S protein) is a large oligomeric transmembrane protein that mediates coronavirus entry into host cells. It contains S1 and S2 subunits. Spike S1 protein contains a receptor binding domain (RBD) that recognizes a variety of host cell surface receptors including angiotensin-converting enzyme 2 (ACE2).

A DNA sequence encoding the SARS-CoV-2 Spike Protein (RBD) (YP_009724390.1) (Arg319-Phe541) was expressed with a polyhistidine tag and AviTag at the N-terminus. 

Catalog number: COVRBD-301-1 (0.1 mg); COVRBD-301-2 (1 mg)

Sequence:

MGHHHHHHHHGLNDIFEAQKIEWHERVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSAS

FSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLY

RLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNL

VKNKCVNF

Expression host: Escherichia coli (E. coli).

Species: SARS-CoV-2

Expressed Region of S1: Arg319-Phe541

Predicted molecular weight: 28.2 kDa

Tags: His, AviTag

Purity: > 90% as analyzed by SDS-PAGE

Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, 1 mM DTT and 50% Glycerol. 

Storage: The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles. The shelf life of the product is unspecified.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

3D print image of a spike protein on the surface of SARS-CoV-2 (Credit: the NIH 3D Print Exchange at 3dprint.nih.gov; NIH)


Share this Product


More from this collection