![SARS-CoV-2 Membrane Protein, Recombinant, AviTag](http://amidbiosciences.com/cdn/shop/products/SARS_Proteins_1024x1024.jpg?v=1614118750)
Amid Biosciences | Protein Engineering Company
SARS-CoV-2 Membrane Protein, Recombinant, AviTag
The coronavirus membrane protein (M protein) is a major structural component of the viral envelope and a determinant of virus assembly.
A DNA sequence encoding the SARS-CoV-2 M protein was expressed with a polyhistidine tag and AviTag at the N-terminus.
Catalog number: COVM-301
Expression host: Escherichia coli (E. coli).
Species: SARS-CoV-2
Expressed Region of M protein: Met1-Gln222
Sequence:
MGHHHHHHHHGLNDIFEAQKIEWHEMADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLW
LLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLE
SELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSD
NIALLVQ
Predicted molecular weight: 28.2 kDa
Tags: His, AviTag
Purity: > 90% as analyzed by SDS-PAGE
Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, 1 mM DTT and 50% Glycerol.
Storage: The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles. The shelf life of the product is unspecified.
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
3D print images of a SARS-CoV-2 virus particle (back) and the spike protein (foreground) . On the virus model, the virus surface (blue) is covered with spike proteins (red) that enable the virus to enter and infect human cells. (Credit: the NIH 3D Print Exchange at 3dprint.nih.gov; NIH).