Amid Biosciences | Protein Engineering Company
Saposin D, Human, Recombinant
Saposin D is a sphingolipid activator protein required for the lysosomal breakdown of ceramide to a fatty acid and sphingosine by acid ceramidase. Human saposin D is derived from a precursor, prosaposin, by proteolytic cleavage.
Recombinant human saposin D is produced in E. coli and purified by proprietary chromatography techniques.
Saposin D sequence:
DGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS
Catalog # SAPD-301-1
Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol.
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
International Shipping: Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates
This product is for laboratory research use only.