Protein Engineering Company
Cart 0
SARS-CoV-2 Membrane Protein, Recombinant, Biotinylated

Amid Biosciences | Protein Engineering Company

SARS-CoV-2 Membrane Protein, Recombinant, Biotinylated

$ 500.00

The coronavirus membrane protein (M protein) is a major structural component of the viral envelope and a determinant of virus assembly.

A DNA sequence encoding the SARS-CoV-2 M protein was expressed with a polyhistidine tag and AviTag at the N-terminus. The protein was site-specifically biotinylated at AviTag with BirA enzyme.

Catalog number: COVM-B-301

Expression host: Escherichia coli (E. coli).

Species: SARS-CoV-2

Expressed Region of M protein: Met1-Gln222

Sequence:

MGHHHHHHHHGLNDIFEAQKIEWHEMADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLW

LLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLE

SELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSD

NIALLVQ

Predicted molecular weight: 28.4 kDa

Tags: His, AviTag

Purity: > 90% as analyzed by SDS-PAGE

Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, 1 mM DTT and 50% Glycerol. 

Storage: The product can be stored at -20°C or below. Avoid repeated freezing and thawing cycles. The shelf life of the product is unspecified.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

3D print images of a SARS-CoV-2 virus particle (back) and the spike protein (foreground) . On the virus model, the virus surface (blue) is covered with spike proteins (red) that enable the virus to enter and infect human cells. (Credit: the NIH 3D Print Exchange at 3dprint.nih.gov; NIH).


Share this Product