Protein Engineering Company
Cart 0
TL1A Protein, Human, Recombinant, Biotinylated

Amid Biosciences | Protein Engineering Company

TL1A Protein, Human, Recombinant, Biotinylated

$ 500.00

TL1A, also known as TNFSF15, is a tumor necrosis factor (TNF) family member cytokine expressed by monocytes, macrophages, dendritic cells (DCs), synovial fibroblasts, and endothelial cells. Its cell surface receptor, DR3 (also known as TNFSF25, WSL-1, TRAMP, and LARD), is mainly expressed by T cells. TL1A has been linked to human inflammatory bowel disease (IBD). 

A DNA sequence encoding the human TL1A (Qln58-Leu251) with a polyhistidine tag and AviTag™ peptide at the N-terminus was expressed in E. coli and biotinylated at AviTag™. Based on the size-exclusion chromatography data, the purified protein elutes as a trimer.

Sequence of recombinant human TL1A protein:

MHHHHHHGSGLNDIFEAQKIEWHEGGSQLRAQGEASVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQ

FPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQ

LLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Catalog# TL1A-B-301

Storage buffer: 20 mM Tris-HCl, pH 7.5, 100 mM NaCl, 1 mM DTT and 50% Glycerol. 
Concentration: 1.0 mg/mL by A280 

Molecular weight: ~25 kDa (monomer)
Purity: >90% by Coomassie staining 
Storage is recommended at -20°C for longer periods of time. 

International Shipping:  Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates.

For Bulk Orders or Custom Packaging:  please contact info@amidbiosciences.com

This product is for laboratory research use only.


Share this Product


More from this collection